PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G224800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 229aa    MW: 26355.2 Da    PI: 8.4844
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G224800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-171057148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT++Ed +lv+ v+++G ++W+ Ia+  g++Rt+k+c++rw +yl
  Sobic.005G224800.1.p 10 KGPWTEQEDMQLVCTVRLFGDRRWDFIAQVSGLNRTGKSCRLRWVNYL 57
                          79********************************************97 PP

2Myb_DNA-binding55.11.8e-1764108248
                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           gr++++E+ l++++++++G++ W++Iar+++ gRt++++k++w++++
  Sobic.005G224800.1.p  64 GRMSPQEERLIIELHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 108
                           89*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.735557IPR017930Myb domain
SuperFamilySSF466891.36E-298104IPR009057Homeodomain-like
SMARTSM007171.1E-14959IPR001005SANT/Myb domain
PfamPF002494.6E-161057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-201164IPR009057Homeodomain-like
CDDcd001671.10E-101257No hitNo description
PROSITE profilePS5129426.17258112IPR017930Myb domain
SMARTSM007171.8E-1662110IPR001005SANT/Myb domain
PfamPF002498.4E-1664107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-2465111IPR009057Homeodomain-like
CDDcd001676.45E-1265108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MVTVREEMRK GPWTEQEDMQ LVCTVRLFGD RRWDFIAQVS GLNRTGKSCR LRWVNYLHPG  60
LKHGRMSPQE ERLIIELHAR WGNRWSRIAR RLPGRTDNEI KNYWRTHMRK KAQERKMSMS  120
SPSSSCSSLT YQACHLDTVP VIGMSSGDTH NGGCVTSALE NTQSVMDGYP MDQIWKEIEA  180
PQAPALLGIA EGKEKTCSSI PCHLPSSAMW DYKYPEVFWK MEDQEIMM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-2871121105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.84450.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM3874100.0KM387410.1 Saccharum officinarum cultivar Badila R2R3-MYB transcription factor variant 1 mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001149882.11e-151MYB59
SwissprotQ53NK61e-129MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLC3S3G11e-155C3S3G1_SACOF; MYB transcription factor MYBAS1
TrEMBLF2W4031e-155F2W403_9POAL; MYB transcription factor
STRINGGRMZM2G048136_P021e-149(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.32e-72myb domain protein 59